SDCBP antibody

Catalog No. ABIN630291

The Rabbit Polyclonal anti-SDCBP antibody (ABIN630291) specifically detects SDCBP in WB and IHC. The antibody is reactive with Human, Rat, Mouse and Dog samples.

Quick Overview for SDCBP antibody (ABIN630291)

Target: SDCBP (Syndecan Binding Protein (Syntenin) (SDCBP))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SDCBP antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SDCBP Antibody

Purification: Purified

Immunogen: SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SDCBP Blocking Peptide, (ABIN5616022), is also available for use as a blocking control in assays to test for specificity of this SDCBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDCBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SDCBP

Target: SDCBP (Syndecan Binding Protein (Syntenin) (SDCBP))

Alternative Name: SDCBP

Background: SDCBP was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.

Molecular Weight: 32 kDa (MW of target protein)