Occludin antibody (N-Term)

Catalog No. ABIN630294

This anti-Occludin antibody is a Rabbit Polyclonal antibody detecting Occludin in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for Occludin antibody (N-Term) (ABIN630294)

Target: Occludin (OCLN)

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Occludin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Occludin Antibody

Binding Specificity: N-Term

Specificity: Occludin antibody was raised against the N terminal of OCLN

Purification: Purified

Immunogen: Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Occludin Blocking Peptide, (ABIN5615104), is also available for use as a blocking control in assays to test for specificity of this Occludin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCLN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Occludin

Target: Occludin (OCLN)

Alternative Name: Occludin

Background: OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.

Molecular Weight: 59 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C