TMEM104 antibody (Middle Region)

Catalog No. ABIN630297

This anti-TMEM104 antibody is a Rabbit Polyclonal antibody detecting TMEM104 in WB. Suitable for Human.

Quick Overview for TMEM104 antibody (Middle Region) (ABIN630297)

Target: TMEM104 (Transmembrane Protein 104 (TMEM104))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM104 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM104 Antibody

Binding Specificity: Middle Region

Specificity: TMEM104 antibody was raised against the middle region of TMEM104

Purification: Purified

Immunogen: TMEM104 antibody was raised using the middle region of TMEM104 corresponding to a region with amino acids GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM104 Blocking Peptide, (ABIN938586), is also available for use as a blocking control in assays to test for specificity of this TMEM104 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM104 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM104

Target: TMEM104 (Transmembrane Protein 104 (TMEM104))

Alternative Name: TMEM104

Background: The function of TMEM104 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 35 kDa (MW of target protein)