ZFYVE27 antibody (Middle Region)

Catalog No. ABIN630302

The Rabbit Polyclonal anti-ZFYVE27 antibody is suitable to detect ZFYVE27 in samples from Human, Rat, Mouse and Dog. It has been validated for WB.

Quick Overview for ZFYVE27 antibody (Middle Region) (ABIN630302)

Target: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZFYVE27 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZFYVE27 Antibody

Binding Specificity: Middle Region

Specificity: ZFYVE27 antibody was raised against the middle region of ZFYVE27

Purification: Purified

Immunogen: ZFYVE27 antibody was raised using the middle region of ZFYVE27 corresponding to a region with amino acids VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETH

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZFYVE27 Blocking Peptide, (ABIN5617113), is also available for use as a blocking control in assays to test for specificity of this ZFYVE27 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZFYVE27 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZFYVE27

Target: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Alternative Name: ZFYVE27

Background: ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway