KIAA0319 antibody (N-Term)

Catalog No. ABIN630311

The Rabbit Polyclonal anti-KIAA0319 antibody has been validated for WB and IHC. It is suitable to detect KIAA0319 in samples from Human.

Quick Overview for KIAA0319 antibody (N-Term) (ABIN630311)

Target: KIAA0319

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIAA0319 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-KIAA0319 Antibody

Binding Specificity: N-Term

Specificity: KIAA0319 antibody was raised against the N terminal of KIAA0319

Purification: Purified

Immunogen: KIAA0319 antibody was raised using the N terminal of KIAA0319 corresponding to a region with amino acids EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA0319 Blocking Peptide, (ABIN937762), is also available for use as a blocking control in assays to test for specificity of this KIAA0319 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0319 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIAA0319

Target: KIAA0319

Alternative Name: KIAA0319

Background: KIAA0319 has been strongly associated with developmental dyslexia.

Molecular Weight: 56 kDa (MW of target protein)