KIAA0319 antibody (N-Term)
-
- Target See all KIAA0319 Antibodies
- KIAA0319
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIAA0319 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- KIAA0319 antibody was raised against the N terminal of KIAA0319
- Purification
- Purified
- Immunogen
- KIAA0319 antibody was raised using the N terminal of KIAA0319 corresponding to a region with amino acids EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG
- Top Product
- Discover our top product KIAA0319 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIAA0319 Blocking Peptide, catalog no. 33R-2376, is also available for use as a blocking control in assays to test for specificity of this KIAA0319 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0319 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIAA0319
- Alternative Name
- KIAA0319 (KIAA0319 Products)
- Synonyms
- DYLX2 antibody, DYX2 antibody, 4930451E12Rik antibody, Kiaa0319 antibody, KIAA0319 antibody, RIKEN cDNA D130043K22 gene antibody, KIAA0319 ortholog antibody, similar to mKIAA0319 protein antibody, KIAA0319 antibody, D130043K22Rik antibody, RGD1307443 antibody
- Background
- KIAA0319 has been strongly associated with developmental dyslexia.
- Molecular Weight
- 56 kDa (MW of target protein)
-