SLC25A29 antibody (C-Term)

Catalog No. ABIN630313

This Rabbit Polyclonal antibody specifically detects SLC25A29 in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for SLC25A29 antibody (C-Term) (ABIN630313)

Target: SLC25A29 (Solute Carrier Family 25, Member 29 (SLC25A29))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A29 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A29 Antibody

Binding Specificity: C-Term

Specificity: SLC25 A29 antibody was raised against the C terminal of SLC25 29

Purification: Purified

Immunogen: SLC25 A29 antibody was raised using the C terminal of SLC25 29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A29 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SLC25A29 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A29

Target: SLC25A29 (Solute Carrier Family 25, Member 29 (SLC25A29))

Alternative Name: SLC25A29

Background: SLC25A29 belongs to the mitochondrial carrier family and it may has palmitoylcarnitine transporting activity.

Molecular Weight: 33 kDa (MW of target protein)