SLC25A16 antibody (N-Term)

Catalog No. ABIN630321

The Rabbit Polyclonal anti-SLC25A16 antibody (ABIN630321) specifically detects SLC25A16 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for SLC25A16 antibody (N-Term) (ABIN630321)

Target: SLC25A16 (Solute Carrier Family 25 (Mitochondrial Carrier, Graves Disease Autoantigen), Member 16 (SLC25A16))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A16 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A16 Antibody

Binding Specificity: N-Term

Specificity: SLC25 A16 antibody was raised against the N terminal of SLC25 16

Purification: Purified

Immunogen: SLC25 A16 antibody was raised using the N terminal of SLC25 16 corresponding to a region with amino acids KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A16 Blocking Peptide, (ABIN940083), is also available for use as a blocking control in assays to test for specificity of this SLC25A16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A16

Target: SLC25A16 (Solute Carrier Family 25 (Mitochondrial Carrier, Graves Disease Autoantigen), Member 16 (SLC25A16))

Alternative Name: SLC25A16

Background: SLC25A16 is a protein that contains three tandemly repeated mitochondrial carrier protein domains. The protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. SLC25A16 gene has a possible role in Graves' disease.

Molecular Weight: 36 kDa (MW of target protein)