SLC25A14 antibody

Catalog No. ABIN630323

The Rabbit Polyclonal anti-SLC25A14 antibody has been validated for WB. It is suitable to detect SLC25A14 in samples from Human, Mouse, Rat and Dog.

Quick Overview for SLC25A14 antibody (ABIN630323)

Target: SLC25A14 (Solute Carrier Family 25 (Mitochondrial Carrier, Brain), Member 14 (SLC25A14))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A14 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A14 Antibody

Purification: Purified

Immunogen: SLC25 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A14 Blocking Peptide, (ABIN5616210), is also available for use as a blocking control in assays to test for specificity of this SLC25A14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A14

Target: SLC25A14 (Solute Carrier Family 25 (Mitochondrial Carrier, Brain), Member 14 (SLC25A14))

Alternative Name: SLC25A14

Background: Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. SLC25A14 has an N-terminal hydrophobic domain that is not present in other UCPs.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Proton Transport