LETM1 antibody (Middle Region)

Catalog No. ABIN630325

This Rabbit Polyclonal antibody specifically detects LETM1 in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for LETM1 antibody (Middle Region) (ABIN630325)

Target: LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LETM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LETM1 Antibody

Binding Specificity: Middle Region

Specificity: LETM1 antibody was raised against the middle region of LETM1

Purification: Purified

Immunogen: LETM1 antibody was raised using the middle region of LETM1 corresponding to a region with amino acids MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LETM1 Blocking Peptide, (ABIN5614445), is also available for use as a blocking control in assays to test for specificity of this LETM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LETM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LETM1

Target: LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))

Alternative Name: LETM1

Background: The LETM1 is a factor of the mitochondrial K+ homeostasis with a potential role in the Wolf-Hirschhorn syndrome.

Molecular Weight: 60 kDa (MW of target protein)