SLC38A1 antibody (Middle Region)

Catalog No. ABIN630327

This anti-SLC38A1 antibody is a Rabbit Polyclonal antibody detecting SLC38A1 in WB and IHC. Suitable for Human.

Quick Overview for SLC38A1 antibody (Middle Region) (ABIN630327)

Target: SLC38A1 (Solute Carrier Family 38 Member 1 (SLC38A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC38A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SLC38A1 Antibody

Binding Specificity: Middle Region

Specificity: SLC38 A1 antibody was raised against the middle region of SLC38 1

Purification: Purified

Immunogen: SLC38 A1 antibody was raised using the middle region of SLC38 1 corresponding to a region with amino acids LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC38A1 Blocking Peptide, (ABIN940542), is also available for use as a blocking control in assays to test for specificity of this SLC38A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC38A1

Target: SLC38A1 (Solute Carrier Family 38 Member 1 (SLC38A1))

Alternative Name: SLC38A1

Background: Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.

Molecular Weight: 54 kDa (MW of target protein)