Corin antibody (C-Term)

Catalog No. ABIN630332

The Rabbit Polyclonal anti-Corin antibody has been validated for WB. It is suitable to detect Corin in samples from Human.

Quick Overview for Corin antibody (C-Term) (ABIN630332)

Target: Corin (CORIN) (Corin, Serine Peptidase (CORIN))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Corin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Corin Antibody

Binding Specificity: C-Term

Specificity: CORIN antibody was raised against the C terminal of CORIN

Purification: Purified

Immunogen: CORIN antibody was raised using the C terminal of CORIN corresponding to a region with amino acids HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CORIN Blocking Peptide, (ABIN939203), is also available for use as a blocking control in assays to test for specificity of this CORIN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CORIN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Corin

Target: Corin (CORIN) (Corin, Serine Peptidase (CORIN))

Alternative Name: CORIN

Background: CORIN is a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. CORIN converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase.

Molecular Weight: 74 kDa (MW of target protein)

Pathways: Regulation of Systemic Arterial Blood Pressure by Hormones