SRPRB antibody (C-Term)

Catalog No. ABIN630341

The Rabbit Polyclonal anti-SRPRB antibody has been validated for WB. It is suitable to detect SRPRB in samples from Human.

Quick Overview for SRPRB antibody (C-Term) (ABIN630341)

Target: SRPRB (Signal Recognition Particle Receptor, B Subunit (SRPRB))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRPRB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SRPRB Antibody

Binding Specificity: C-Term

Specificity: SRPRB antibody was raised against the C terminal of SRPRB

Purification: Purified

Immunogen: SRPRB antibody was raised using the C terminal of SRPRB corresponding to a region with amino acids APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SRPRB Blocking Peptide, (ABIN936801), is also available for use as a blocking control in assays to test for specificity of this SRPRB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRPRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRPRB

Target: SRPRB (Signal Recognition Particle Receptor, B Subunit (SRPRB))

Alternative Name: SRPRB

Background: SRPRB has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling