CHIC1 antibody (N-Term)

Catalog No. ABIN630348

This anti-CHIC1 antibody is a Rabbit Polyclonal antibody detecting CHIC1 in WB. Suitable for Human, Mouse, Rat, Zebrafish (Danio rerio) and Dog.

Quick Overview for CHIC1 antibody (N-Term) (ABIN630348)

Target: CHIC1 (Cysteine-Rich Hydrophobic Domain 1 (CHIC1))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHIC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHIC1 Antibody

Binding Specificity: N-Term

Specificity: CHIC1 antibody was raised against the N terminal of CHIC1

Purification: Purified

Immunogen: CHIC1 antibody was raised using the N terminal of CHIC1 corresponding to a region with amino acids LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHIC1 Blocking Peptide, (ABIN5612849), is also available for use as a blocking control in assays to test for specificity of this CHIC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHIC1

Target: CHIC1 (Cysteine-Rich Hydrophobic Domain 1 (CHIC1))

Alternative Name: CHIC1

Background: The function of CHIC protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 24 kDa (MW of target protein)