SLC19A1 antibody

Catalog No. ABIN630376

This Rabbit Polyclonal antibody specifically detects SLC19A1 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for SLC19A1 antibody (ABIN630376)

Target: SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC19A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SLC19A1 Antibody

Purification: Purified

Immunogen: SLC19 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC19A1 Blocking Peptide, (ABIN5616188), is also available for use as a blocking control in assays to test for specificity of this SLC19A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC19A1

Target: SLC19A1 (Solute Carrier Family 19 (Folate Transporter), Member 1 (SLC19A1))

Alternative Name: SLC19A1

Background: Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport