UST antibody (C-Term)

Catalog No. ABIN630398

The Rabbit Polyclonal anti-UST antibody is suitable to detect UST in samples from Human, Dog, Mouse and Rat. It has been validated for WB and IHC.

Quick Overview for UST antibody (C-Term) (ABIN630398)

Target: UST (Uronyl-2-Sulfotransferase (UST))

Reactivity: Human, Dog, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UST antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-UST Antibody

Binding Specificity: C-Term

Specificity: UST antibody was raised against the C terminal of UST

Purification: Purified

Immunogen: UST antibody was raised using the C terminal of UST corresponding to a region with amino acids YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UST Blocking Peptide, (ABIN936056), is also available for use as a blocking control in assays to test for specificity of this UST antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UST antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UST

Target: UST (Uronyl-2-Sulfotransferase (UST))

Alternative Name: UST

Background: UST catalyzes the transfer of sulfate to the position 2 of uronyl residues. UST has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. It has no activity toward desulfated N-resulfated heparin.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process