UBE2D2 antibody

Catalog No. ABIN630401

The Rabbit Polyclonal anti-UBE2D2 antibody has been validated for WB and IHC. It is suitable to detect UBE2D2 in samples from Human, Mouse, Rat and Dog.

Quick Overview for UBE2D2 antibody (ABIN630401)

Target: UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2D2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-UBE2D2 Antibody

Purification: Purified

Immunogen: UBE2 D2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2D2 Blocking Peptide, (ABIN5616861), is also available for use as a blocking control in assays to test for specificity of this UBE2D2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2D2

Target: UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))

Alternative Name: UBE2D2

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades