SLC25A24 antibody

Catalog No. ABIN630404

The Rabbit Polyclonal anti-SLC25A24 antibody has been validated for WB. It is suitable to detect SLC25A24 in samples from Human, Mouse and Rat.

Quick Overview for SLC25A24 antibody (ABIN630404)

Target: SLC25A24 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 24 (SLC25A24))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A24 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A24 Antibody

Purification: Purified

Immunogen: SLC25 A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A24 Blocking Peptide, (ABIN938346), is also available for use as a blocking control in assays to test for specificity of this SLC25A24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A24

Target: SLC25A24 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 24 (SLC25A24))

Alternative Name: SLC25A24

Background: SLC25A24 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.

Molecular Weight: 45 kDa (MW of target protein)