SLC6A8 antibody

Catalog No. ABIN630409

This Rabbit Polyclonal antibody specifically detects SLC6A8 in WB and IHC. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for SLC6A8 antibody (ABIN630409)

Target: SLC6A8 (Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC6A8 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SLC6A8 Antibody

Purification: Purified

Immunogen: SLC6 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC6A8 Blocking Peptide, (ABIN937056), is also available for use as a blocking control in assays to test for specificity of this SLC6A8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC6A8

Target: SLC6A8 (Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8))

Alternative Name: SLC6A8

Background: SLC6A8 is required for the uptake of creatine in muscles and brain.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding, ER-Nucleus Signaling, Unfolded Protein Response