FGG antibody (Middle Region)

Catalog No. ABIN630420

This anti-FGG antibody is a Rabbit Polyclonal antibody detecting FGG in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for FGG antibody (Middle Region) (ABIN630420)

Target: FGG (Fibrinogen gamma Chain (FGG))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FGG antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FGG Antibody

Binding Specificity: Middle Region

Specificity: FGG antibody was raised against the middle region of FGG

Purification: Purified

Immunogen: FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FGG Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this FGG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FGG

Target: FGG (Fibrinogen gamma Chain (FGG))

Alternative Name: FGG

Background: FGG is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia.

Molecular Weight: 46 kDa (MW of target protein)