Glucuronidase beta antibody (C-Term)

Catalog No. ABIN630431

The Rabbit Polyclonal anti-Glucuronidase beta antibody has been validated for WB and IHC. It is suitable to detect Glucuronidase beta in samples from Human.

Quick Overview for Glucuronidase beta antibody (C-Term) (ABIN630431)

Target: Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Glucuronidase beta antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Glucuronidase beta Antibody

Binding Specificity: C-Term

Specificity: GUSB antibody was raised against the C terminal of GUSB

Purification: Purified

Immunogen: GUSB antibody was raised using the C terminal of GUSB corresponding to a region with amino acids VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GUSB Blocking Peptide, (ABIN5613911), is also available for use as a blocking control in assays to test for specificity of this GUSB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUSB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Glucuronidase beta

Target: Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))

Alternative Name: GUSB

Background: GUSB plays an important role in the degradation of dermatan and keratan sulfates.

Molecular Weight: 72 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process