LCAT antibody (N-Term)

Catalog No. ABIN630433

This Rabbit Polyclonal antibody specifically detects LCAT in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for LCAT antibody (N-Term) (ABIN630433)

Target: LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LCAT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LCAT Antibody

Binding Specificity: N-Term

Specificity: LCAT antibody was raised against the N terminal of LCAT

Purification: Purified

Immunogen: LCAT antibody was raised using the N terminal of LCAT corresponding to a region with amino acids MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVI

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LCAT Blocking Peptide, (ABIN5614425), is also available for use as a blocking control in assays to test for specificity of this LCAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LCAT

Target: LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))

Alternative Name: LCAT

Background: LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Lipid Metabolism