LRPAP1 antibody (C-Term)

Catalog No. ABIN630434

The Rabbit Polyclonal anti-LRPAP1 antibody has been validated for WB and IHC. It is suitable to detect LRPAP1 in samples from Human, Mouse, Rat and Dog.

Quick Overview for LRPAP1 antibody (C-Term) (ABIN630434)

Target: LRPAP1 (Low Density Lipoprotein Receptor-Related Protein Associated Protein 1 (LRPAP1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRPAP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-LRPAP1 Antibody

Binding Specificity: C-Term

Specificity: LRPAP1 antibody was raised against the C terminal of LRPAP1

Purification: Purified

Immunogen: LRPAP1 antibody was raised using the C terminal of LRPAP1 corresponding to a region with amino acids IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRH

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRPAP1 Blocking Peptide, (ABIN939308), is also available for use as a blocking control in assays to test for specificity of this LRPAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRPAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRPAP1

Target: LRPAP1 (Low Density Lipoprotein Receptor-Related Protein Associated Protein 1 (LRPAP1))

Alternative Name: LRPAP1

Background: LRPAP1 interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330.

Molecular Weight: 39 kDa (MW of target protein)