PPIB antibody

Catalog No. ABIN630436

This Rabbit Polyclonal antibody specifically detects PPIB in WB and IHC. It exhibits reactivity toward Human, Mouse and Dog.

Quick Overview for PPIB antibody (ABIN630436)

Target: PPIB (Cyclophilin B (PPIB))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPIB antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PPIB Antibody

Purification: Purified

Immunogen: PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids FITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPIB Blocking Peptide, (ABIN938323), is also available for use as a blocking control in assays to test for specificity of this PPIB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPIB

Target: PPIB (Cyclophilin B (PPIB))

Alternative Name: PPIB

Background: PPIB is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression.

Molecular Weight: 24 kDa (MW of target protein)