IL-10RA antibody (N-Term)

Catalog No. ABIN630438

This anti-IL-10RA antibody is a Rabbit Polyclonal antibody detecting IL-10RA in WB. Suitable for Human.

Quick Overview for IL-10RA antibody (N-Term) (ABIN630438)

Target: IL-10RA (IL10RA) (Interleukin 10 Receptor, alpha (IL10RA))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL-10RA antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IL-10RA Antibody

Binding Specificity: N-Term

Specificity: IL10 R Alpha antibody was raised against the N terminal of IL10 A

Purification: Purified

Immunogen: IL10 R Alpha antibody was raised using the N terminal of IL10 A corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL10R Alpha Blocking Peptide, (ABIN938981), is also available for use as a blocking control in assays to test for specificity of this IL10R Alpha antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL-10RA

Target: IL-10RA (IL10RA) (Interleukin 10 Receptor, alpha (IL10RA))

Alternative Name: IL10R alpha

Background: IL10RA is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: Growth Factor Binding