SULF2 antibody (C-Term)

Catalog No. ABIN630454

This Rabbit Polyclonal antibody specifically detects SULF2 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for SULF2 antibody (C-Term) (ABIN630454)

Target: SULF2 (Sulfatase 2 (SULF2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SULF2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SULF2 Antibody

Binding Specificity: C-Term

Specificity: SULF2 antibody was raised against the C terminal of SULF2

Purification: Purified

Immunogen: SULF2 antibody was raised using the C terminal of SULF2 corresponding to a region with amino acids DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SULF2 Blocking Peptide, (ABIN937604), is also available for use as a blocking control in assays to test for specificity of this SULF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SULF2

Target: SULF2 (Sulfatase 2 (SULF2))

Alternative Name: SULF2

Background: Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules.

Molecular Weight: 98 kDa (MW of target protein)