TM9SF1 antibody (N-Term)

Catalog No. ABIN630456

This anti-TM9SF1 antibody is a Rabbit Polyclonal antibody detecting TM9SF1 in WB and IHC. Suitable for Human, Mouse, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for TM9SF1 antibody (N-Term) (ABIN630456)

Target: TM9SF1 (Transmembrane 9 Superfamily Member 1 (TM9SF1))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TM9SF1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-TM9SF1 Antibody

Binding Specificity: N-Term

Specificity: TM9 SF1 antibody was raised against the N terminal of TM9 F1

Purification: Purified

Immunogen: TM9 SF1 antibody was raised using the N terminal of TM9 F1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TM9SF1 Blocking Peptide, (ABIN937836), is also available for use as a blocking control in assays to test for specificity of this TM9SF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TM9SF1

Target: TM9SF1 (Transmembrane 9 Superfamily Member 1 (TM9SF1))

Alternative Name: TM9SF1

Background: TM9SF1 may function as channel, small molecule transporter or receptor.

Molecular Weight: 67 kDa (MW of target protein)