PLP2 antibody

Catalog No. ABIN630464

The Rabbit Polyclonal anti-PLP2 antibody has been validated for WB. It is suitable to detect PLP2 in samples from Human and Dog.

Quick Overview for PLP2 antibody (ABIN630464)

Target: PLP2 (Proteolipid Protein 2 (PLP2))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PLP2 Antibody

Purification: Purified

Immunogen: PLP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLP2 Blocking Peptide, (ABIN5615423), is also available for use as a blocking control in assays to test for specificity of this PLP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLP2

Target: PLP2 (Proteolipid Protein 2 (PLP2))

Alternative Name: PLP2

Background: PLP2 may play a role in cell differentiation in the intestinal epithelium.

Molecular Weight: 17 kDa (MW of target protein)