Calmegin antibody (N-Term)

Catalog No. ABIN630467

The Rabbit Polyclonal anti-Calmegin antibody has been validated for WB. It is suitable to detect Calmegin in samples from Human.

Quick Overview for Calmegin antibody (N-Term) (ABIN630467)

Target: Calmegin (CLGN)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Calmegin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Calmegin Antibody

Binding Specificity: N-Term

Specificity: Calmegin antibody was raised against the N terminal of CLGN

Purification: Purified

Immunogen: Calmegin antibody was raised using the N terminal of CLGN corresponding to a region with amino acids YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Calmegin Blocking Peptide, (ABIN936124), is also available for use as a blocking control in assays to test for specificity of this Calmegin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLGN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Calmegin

Target: Calmegin (CLGN)

Alternative Name: Calmegin

Background: Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneis and infertility.

Molecular Weight: 70 kDa (MW of target protein)