STS antibody

Catalog No. ABIN630487

Product Details anti-STS Antibody

Target: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STS antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: STS antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSW

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STS Blocking Peptide, catalog no. 33R-5135, is also available for use as a blocking control in assays to test for specificity of this STS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STS

Target: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Alternative Name: STS (STS Products)

Background: STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosisThe protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI).

Molecular Weight: 64 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis