HNF4 gamma antibody (N-Term)
-
- Target See all HNF4 gamma (HNF4G) Antibodies
- HNF4 gamma (HNF4G) (Hepatocyte Nuclear Factor 4 gamma (HNF4G))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNF4 gamma antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HNF4 G antibody was raised against the N terminal of HNF4
- Purification
- Affinity purified
- Immunogen
- HNF4 G antibody was raised using the N terminal of HNF4 corresponding to a region with amino acids MDMANYSEVLDPTYTTLEFETMQILYNSSDSSAPETSMNTTDNGVNCLCA
- Top Product
- Discover our top product HNF4G Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNF4G Blocking Peptide, catalog no. 33R-5851, is also available for use as a blocking control in assays to test for specificity of this HNF4G antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNF4 gamma (HNF4G) (Hepatocyte Nuclear Factor 4 gamma (HNF4G))
- Alternative Name
- HNF4G (HNF4G Products)
- Synonyms
- HNF4G antibody, hnf4gamma antibody, zgc:153265 antibody, NR2A2 antibody, NR2A3 antibody, hepatocyte nuclear factor 4 gamma antibody, hepatocyte nuclear factor 4, gamma antibody, HNF4G antibody, hnf4g antibody, Hnf4g antibody
- Background
- HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse
- Molecular Weight
- 50 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway
-