HNF4 gamma antibody (C-Term)

Catalog No. ABIN630491

The Rabbit Polyclonal anti-HNF4 gamma antibody has been validated for WB. It is suitable to detect HNF4 gamma in samples from Human, Mouse and Rat.

Quick Overview for HNF4 gamma antibody (C-Term) (ABIN630491)

Target: HNF4 gamma (HNF4G) (Hepatocyte Nuclear Factor 4 gamma (HNF4G))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNF4 gamma antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HNF4 gamma Antibody

Binding Specificity: C-Term

Specificity: HNF4 G antibody was raised against the C terminal of HNF4

Purification: Affinity purified

Immunogen: HNF4 G antibody was raised using the C terminal of HNF4 corresponding to a region with amino acids QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNF4G Blocking Peptide, (ABIN5614037), is also available for use as a blocking control in assays to test for specificity of this HNF4G antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNF4 gamma

Target: HNF4 gamma (HNF4G) (Hepatocyte Nuclear Factor 4 gamma (HNF4G))

Alternative Name: HNF4G

Background: HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway