Retinoid X Receptor beta antibody (N-Term)

Catalog No. ABIN630492

This anti-Retinoid X Receptor beta antibody is a Rabbit Polyclonal antibody detecting Retinoid X Receptor beta in WB. Suitable for Human.

Quick Overview for Retinoid X Receptor beta antibody (N-Term) (ABIN630492)

Target: Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Retinoid X Receptor beta antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Retinoid X Receptor beta Antibody

Binding Specificity: N-Term

Specificity: RXRB antibody was raised against the N terminal of RXRB

Purification: Affinity purified

Immunogen: RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RXRB Blocking Peptide, (ABIN5615983), is also available for use as a blocking control in assays to test for specificity of this RXRB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Retinoid X Receptor beta

Target: Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))

Alternative Name: RXRB

Background: RXRB is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway