ESRRA antibody (N-Term)

Catalog No. ABIN630497

The Rabbit Polyclonal anti-ESRRA antibody has been validated for WB. It is suitable to detect ESRRA in samples from Human, Mouse and Rat.

Quick Overview for ESRRA antibody (N-Term) (ABIN630497)

Target: ESRRA (Estrogen-Related Receptor alpha (ESRRA))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ESRRA antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ESRRA Antibody

Binding Specificity: N-Term

Specificity: ESRRA antibody was raised against the N terminal of ESRRA

Purification: Affinity purified

Immunogen: ESRRA antibody was raised using the N terminal of ESRRA corresponding to a region with amino acids KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ESRRA Blocking Peptide, (ABIN939722), is also available for use as a blocking control in assays to test for specificity of this ESRRA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESRRA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ESRRA

Target: ESRRA (Estrogen-Related Receptor alpha (ESRRA))

Alternative Name: ESRRA

Background: ESRRA is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha