Retinoid X Receptor gamma antibody (N-Term)

Catalog No. ABIN630498

This anti-Retinoid X Receptor gamma antibody is a Rabbit Polyclonal antibody detecting Retinoid X Receptor gamma in WB. Suitable for Human, Mouse and Rat.

Quick Overview for Retinoid X Receptor gamma antibody (N-Term) (ABIN630498)

Target: Retinoid X Receptor gamma (RXRG) (Retinoid X Receptor, gamma (RXRG))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Retinoid X Receptor gamma antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Retinoid X Receptor gamma Antibody

Binding Specificity: N-Term

Specificity: RXRG antibody was raised against the N terminal of RXRG

Purification: Affinity purified

Immunogen: RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RXRG Blocking Peptide, (ABIN5615985), is also available for use as a blocking control in assays to test for specificity of this RXRG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Retinoid X Receptor gamma

Target: Retinoid X Receptor gamma (RXRG) (Retinoid X Receptor, gamma (RXRG))

Alternative Name: RXRG

Background: RXRG encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. RXRG is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway