CRAT antibody (N-Term)
-
- Target See all CRAT Antibodies
- CRAT (Carnitine O-Acetyltransferase (CRAT))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRAT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CRAT antibody was raised against the N terminal of CRAT
- Purification
- Affinity purified
- Immunogen
- CRAT antibody was raised using the N terminal of CRAT corresponding to a region with amino acids MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVD
- Top Product
- Discover our top product CRAT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CRAT Blocking Peptide, catalog no. 33R-6123, is also available for use as a blocking control in assays to test for specificity of this CRAT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRAT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRAT (Carnitine O-Acetyltransferase (CRAT))
- Alternative Name
- CRAT (CRAT Products)
- Background
- Carnitine acetyltransferase (CRAT) is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Different subcellular localizations of the CRAT mRNAs are thought to result from alternative splicing of the CRAT geneuggested by the divergent sequences in the 5' region of peroxisomal and mitochondrial CRAT cDNAs and the location of an intron where the sequences diverge.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-