CRAT antibody (N-Term)

Catalog No. ABIN630518

Product Details anti-CRAT Antibody

Target: CRAT (Carnitine O-Acetyltransferase (CRAT))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRAT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CRAT antibody was raised against the N terminal of CRAT

Purification: Affinity purified

Immunogen: CRAT antibody was raised using the N terminal of CRAT corresponding to a region with amino acids MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CRAT Blocking Peptide, catalog no. 33R-6123, is also available for use as a blocking control in assays to test for specificity of this CRAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRAT

Target: CRAT (Carnitine O-Acetyltransferase (CRAT))

Alternative Name: CRAT (CRAT Products)

Synonyms: CAT1 antibody, AW107812 antibody, CARAT antibody, CAT antibody, Carnitine acetylase antibody, CrAT antibody, hm:zeh0248 antibody, zgc:92317 antibody, carnitine O-acetyltransferase antibody, carnitine acetyltransferase antibody, Carnitine acetyltransferase antibody, Carnitine acetyltransferase, putative antibody, carnitine O-acetyltransferase a antibody, CRAT antibody, Crat antibody, CNA05200 antibody, CNL05760 antibody, CC1G_06292 antibody, PAS_chr3_0761 antibody, CGB_A5470W antibody, CGB_D1240C antibody, crata antibody

Background: Carnitine acetyltransferase (CRAT) is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Different subcellular localizations of the CRAT mRNAs are thought to result from alternative splicing of the CRAT geneuggested by the divergent sequences in the 5' region of peroxisomal and mitochondrial CRAT cDNAs and the location of an intron where the sequences diverge.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process