C18orf54 antibody
-
- Target See all C18orf54 Antibodies
- C18orf54 (Chromosome 18 Open Reading Frame 54 (C18orf54))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C18orf54 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- C18 ORF54 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLN
- Top Product
- Discover our top product C18orf54 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C18ORF54 Blocking Peptide, catalog no. 33R-7000, is also available for use as a blocking control in assays to test for specificity of this C18ORF54 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF54 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C18orf54 (Chromosome 18 Open Reading Frame 54 (C18orf54))
- Alternative Name
- C18ORF54 (C18orf54 Products)
- Background
- The function of C18orf54 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 58 kDa (MW of target protein)
-