PAX8 antibody (N-Term)
-
- Target See all PAX8 Antibodies
- PAX8 (Paired Box 8 (PAX8))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PAX8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PAX8 antibody was raised against the N terminal of PAX8
- Purification
- Affinity purified
- Immunogen
- PAX8 antibody was raised using the N terminal of PAX8 corresponding to a region with amino acids KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD
- Top Product
- Discover our top product PAX8 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PAX8 Blocking Peptide, catalog no. 33R-4656, is also available for use as a blocking control in assays to test for specificity of this PAX8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAX8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAX8 (Paired Box 8 (PAX8))
- Alternative Name
- PAX8 (PAX8 Products)
- Synonyms
- PAX8 antibody, XPax-8 antibody, XPax8 antibody, pax-8 antibody, PAX-8 antibody, Pax-8 antibody, paired box 8 antibody, paired box 8 L homeolog antibody, PAX8 antibody, pax8 antibody, Pax8 antibody, pax8.L antibody
- Background
- PAX8 is a member of the paired box (PAX) family of transcription factors. Members of this family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in its gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis, Regulation of Hormone Metabolic Process, Stem Cell Maintenance, Tube Formation
-