PRDM15 antibody (Middle Region)

Catalog No. ABIN630539

The Rabbit Polyclonal anti-PRDM15 antibody has been validated for WB. It is suitable to detect PRDM15 in samples from Human, Mouse and Rat.

Quick Overview for PRDM15 antibody (Middle Region) (ABIN630539)

Target: PRDM15 (PR Domain Containing 15 (PRDM15))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRDM15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PRDM15 Antibody

Binding Specificity: Middle Region

Specificity: PRDM15 antibody was raised against the middle region of PRDM15

Purification: Affinity purified

Immunogen: PRDM15 antibody was raised using the middle region of PRDM15 corresponding to a region with amino acids LCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRDM15 Blocking Peptide, (ABIN940205), is also available for use as a blocking control in assays to test for specificity of this PRDM15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDM15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRDM15

Target: PRDM15 (PR Domain Containing 15 (PRDM15))

Alternative Name: PRDM15

Background: PRDM15 may be involved in transcriptional regulation.

Molecular Weight: 134 kDa (MW of target protein)