IFI35 antibody (N-Term)

Catalog No. ABIN630552

Product Details anti-IFI35 Antibody

Target: IFI35 (Interferon-Induced Protein 35 (IFI35))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFI35 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IFI35 antibody was raised against the N terminal of IFI35

Purification: Affinity purified

Immunogen: IFI35 antibody was raised using the N terminal of IFI35 corresponding to a region with amino acids MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFI35 Blocking Peptide, catalog no. 33R-6397, is also available for use as a blocking control in assays to test for specificity of this IFI35 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFI35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFI35

Target: IFI35 (Interferon-Induced Protein 35 (IFI35))

Alternative Name: IFI35 (IFI35 Products)

Synonyms: IFI35 antibody, IFP35 antibody, 2010008K16Rik antibody, AW986054 antibody, ifi-35 antibody, interferon induced protein 35 antibody, interferon-induced protein 35 antibody, IFI35 antibody, ifi35 antibody, Ifi35 antibody

Background: IFI35 has been shown to interact with NMI and BATF.

Molecular Weight: 32 kDa (MW of target protein)