CKM antibody (N-Term)
-
- Target See all CKM Antibodies
- CKM (Creatine Kinase, Muscle (CKM))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CKM antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CKMM antibody was raised against the N terminal of CKM
- Purification
- Affinity purified
- Immunogen
- CKMM antibody was raised using the N terminal of CKM corresponding to a region with amino acids VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL
- Top Product
- Discover our top product CKM Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CKMM Blocking Peptide, catalog no. 33R-9549, is also available for use as a blocking control in assays to test for specificity of this CKMM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Effects of peroxynitrite on isolated cardiac trabeculae: selective impact on myofibrillar energetic controllers." in: Biochimie, Vol. 85, Issue 6, pp. 587-96, (2003) (PubMed).
: "
-
Effects of peroxynitrite on isolated cardiac trabeculae: selective impact on myofibrillar energetic controllers." in: Biochimie, Vol. 85, Issue 6, pp. 587-96, (2003) (PubMed).
-
- Target
- CKM (Creatine Kinase, Muscle (CKM))
- Alternative Name
- CKMM (CKM Products)
- Background
- CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart.
- Molecular Weight
- 43 kDa (MW of target protein)
-