CKM antibody (N-Term)

Catalog No. ABIN630557

The Rabbit Polyclonal anti-CKM antibody has been validated for WB. It is suitable to detect CKM in samples from Human, Mouse, Rat and Dog. There is 1 publication available.

Quick Overview for CKM antibody (N-Term) (ABIN630557)

Target: CKM (Creatine Kinase, Muscle (CKM))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CKM antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CKM Antibody

Binding Specificity: N-Term

Specificity: CKMM antibody was raised against the N terminal of CKM

Purification: Affinity purified

Immunogen: CKMM antibody was raised using the N terminal of CKM corresponding to a region with amino acids VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CKMM Blocking Peptide, (ABIN5612903), is also available for use as a blocking control in assays to test for specificity of this CKMM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-CKM antibody (ABIN630557)

Mihm, Yu, Reiser, Bauer: "Effects of peroxynitrite on isolated cardiac trabeculae: selective impact on myofibrillar energetic controllers." in: Biochimie, Vol. 85, Issue 6, pp. 587-96, (2003) (PubMed).

Target Details for CKM

Target: CKM (Creatine Kinase, Muscle (CKM))

Alternative Name: CKMM

Background: CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart.

Molecular Weight: 43 kDa (MW of target protein)