TSPY-Like 6 antibody (N-Term)

Catalog No. ABIN630567

This anti-TSPY-Like 6 antibody is a Rabbit Polyclonal antibody detecting TSPY-Like 6 in WB. Suitable for Human.

Quick Overview for TSPY-Like 6 antibody (N-Term) (ABIN630567)

Target: TSPY-Like 6 (TSPYL6)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSPY-Like 6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TSPY-Like 6 Antibody

Binding Specificity: N-Term

Specificity: TSPYL6 antibody was raised against the N terminal of TSPYL6

Purification: Affinity purified

Immunogen: TSPYL6 antibody was raised using the N terminal of TSPYL6 corresponding to a region with amino acids MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TSPYL6 Blocking Peptide, (ABIN5616829), is also available for use as a blocking control in assays to test for specificity of this TSPYL6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPYL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSPY-Like 6

Target: TSPY-Like 6 (TSPYL6)

Alternative Name: TSPYL6

Background: The function of TSPYL6 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 46 kDa (MW of target protein)