RPL30 antibody (Middle Region)

Catalog No. ABIN630571

This Rabbit Polyclonal antibody specifically detects RPL30 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RPL30 antibody (Middle Region) (ABIN630571)

Target: RPL30 (Ribosomal Protein L30 (RPL30))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL30 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPL30 Antibody

Binding Specificity: Middle Region

Specificity: RPL30 antibody was raised against the middle region of RPL30

Purification: Affinity purified

Immunogen: RPL30 antibody was raised using the middle region of RPL30 corresponding to a region with amino acids LKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL30 Blocking Peptide, (ABIN940478), is also available for use as a blocking control in assays to test for specificity of this RPL30 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL30

Target: RPL30 (Ribosomal Protein L30 (RPL30))

Alternative Name: RPL30

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron.

Molecular Weight: 13 kDa (MW of target protein)