GUK1 antibody (Middle Region)

Catalog No. ABIN630582

This anti-GUK1 antibody is a Rabbit Polyclonal antibody detecting GUK1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for GUK1 antibody (Middle Region) (ABIN630582)

Target: GUK1 (Guanylate Kinase 1 (GUK1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GUK1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GUK1 Antibody

Binding Specificity: Middle Region

Specificity: GUK1 antibody was raised against the middle region of GUK1

Purification: Affinity purified

Immunogen: GUK1 antibody was raised using the middle region of GUK1 corresponding to a region with amino acids IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GUK1 Blocking Peptide, (ABIN939325), is also available for use as a blocking control in assays to test for specificity of this GUK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GUK1

Target: GUK1 (Guanylate Kinase 1 (GUK1))

Alternative Name: GUK1

Background: GUK1 is essential for recycling GMP and indirectly, cGMP.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process