GTPBP10 antibody

Catalog No. ABIN630593

The Rabbit Polyclonal anti-GTPBP10 antibody has been validated for WB. It is suitable to detect GTPBP10 in samples from Human, Mouse, Rat and Drosophila melanogaster.

Quick Overview for GTPBP10 antibody (ABIN630593)

Target: GTPBP10 (GTP-Binding Protein 10 (GTPBP10))

Reactivity: Human, Mouse, Rat, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GTPBP10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GTPBP10 Antibody

Purification: Affinity purified

Immunogen: GTPBP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GTPBP10 Blocking Peptide, (ABIN937438), is also available for use as a blocking control in assays to test for specificity of this GTPBP10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GTPBP10

Target: GTPBP10 (GTP-Binding Protein 10 (GTPBP10))

Alternative Name: GTPBP10

Background: Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction.

Molecular Weight: 43 kDa (MW of target protein)