HPRT1 antibody

Catalog No. ABIN630595

This Rabbit Polyclonal antibody specifically detects HPRT1 in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for HPRT1 antibody (ABIN630595)

Target: HPRT1 (Hypoxanthine phosphoribosyltransferase 1 (HPRT1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HPRT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HPRT1 Antibody

Purification: Affinity purified

Immunogen: HPRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HPRT1 Blocking Peptide, (ABIN5614065), is also available for use as a blocking control in assays to test for specificity of this HPRT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPRT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HPRT1

Target: HPRT1 (Hypoxanthine phosphoribosyltransferase 1 (HPRT1))

Alternative Name: HPRT1

Background: HPRT1 has a central role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process