DPPA5 antibody (N-Term)

Catalog No. ABIN630614

The Rabbit Polyclonal anti-DPPA5 antibody has been validated for WB. It is suitable to detect DPPA5 in samples from Human.

Quick Overview for DPPA5 antibody (N-Term) (ABIN630614)

Target: DPPA5 (Developmental Pluripotency Associated 5 (DPPA5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPPA5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DPPA5 Antibody

Binding Specificity: N-Term

Specificity: DPPA5 antibody was raised against the N terminal of DPPA5

Purification: Affinity purified

Immunogen: DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPPA5 Blocking Peptide, (ABIN5613253), is also available for use as a blocking control in assays to test for specificity of this DPPA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPPA5

Target: DPPA5 (Developmental Pluripotency Associated 5 (DPPA5))

Alternative Name: DPPA5

Background: DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.

Molecular Weight: 13 kDa (MW of target protein)