PNMA1 antibody (Middle Region)

Catalog No. ABIN630630

The Rabbit Polyclonal anti-PNMA1 antibody (ABIN630630) specifically detects PNMA1 in WB. The antibody is reactive with Human samples.

Quick Overview for PNMA1 antibody (Middle Region) (ABIN630630)

Target: PNMA1 (Paraneoplastic Antigen MA1 (PNMA1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNMA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PNMA1 Antibody

Binding Specificity: Middle Region

Specificity: PNMA1 antibody was raised against the middle region of PNMA1

Purification: Affinity purified

Immunogen: PNMA1 antibody was raised using the middle region of PNMA1 corresponding to a region with amino acids KSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIR

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PNMA1 Blocking Peptide, (ABIN940044), is also available for use as a blocking control in assays to test for specificity of this PNMA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNMA1

Target: PNMA1 (Paraneoplastic Antigen MA1 (PNMA1))

Alternative Name: PNMA1

Background: PNMA1 encodes a protein that is highly restricted to the brain and testis. Anti-PNMA1 reacts mainly with subnuclear elements (including the nucleoli) and to a lesser degree the cytoplasm.

Molecular Weight: 40 kDa (MW of target protein)