PDE9A antibody (N-Term)

Catalog No. ABIN630634

Product Details anti-PDE9A Antibody

Target: PDE9A (phosphodiesterase 9A (PDE9A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDE9A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PDE9 A antibody was raised against the N terminal of PDE9

Purification: Affinity purified

Immunogen: PDE9 A antibody was raised using the N terminal of PDE9 corresponding to a region with amino acids SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDE9A Blocking Peptide, catalog no. 33R-8356, is also available for use as a blocking control in assays to test for specificity of this PDE9A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDE9A

Target: PDE9A (phosphodiesterase 9A (PDE9A))

Alternative Name: PDE9A (PDE9A Products)

Synonyms: PDE9A antibody, MGC116558 antibody, Pde9a antibody, HSPDE9A2 antibody, PDE9A1 antibody, phosphodiesterase 9A antibody, phosphodiesterase 9A S homeolog antibody, high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A antibody, PDE9A antibody, pde9a.S antibody, Pde9a antibody, LOC100549810 antibody, pde9a antibody

Background: PDE9A catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides.

Molecular Weight: 61 kDa (MW of target protein)